AceView: product:AMOTL2.bAug10, a comprehensive annotation of human, mouse and worm genes with mRNAs or ESTsAceView.
Homo sapiens
angiomotin like 2 (85.8 kD) () alternative variant bAug10, complete mRNA.
This complete mRNA is
long. It is reconstructed from 461 , some from hippocampus (seen 45 times), brain (43), placenta (33), uterus (20), thalamus (19), cerebellum (18), lung (15) and 109 other .
The premessenger has 10
and covers
on the NCBI 37, August 2010 genome. The predicted protein has
(85.8 kDa, pI 7.6). It is exactly encoded by , and with some amino-acid variations by
[E732D] (available from ),
It contains a second peroximal domain,
a coiled coil stretch [Psort2]. It contains no Pfam protein domain.
identify related proteins (threshold .001) in Bilateria.
To mine knowledge about the gene, please click the
tab at the top of the page
Please choose between the ., and the .
This diagram shows in true scale the gene on the genome, the mRNAs and the cDNA clones.
The diagram shows in pink (the wide colored part is the best predicted protein, the thin empty parts are the UTRs), from 5' (top) to 3' (bottom), the AceView mRNA reconstructed from the GenBank cDNA sequences (in black to the right). Protein annotations are displayed to the left.
On the pink mRNA are indicated, as wide boxes, the predicted protein(s), colored according to their protein coding score (pink for good, blue for less good, yellow for dubious),, the untranslated regions (UTRs, thin and empty), and the eventual validated 5' and 3' ends (flags down or up). Introns have been spliced out, leaving triangles behind.
To the right of the mRNA are the GenBank sequences matching and defining the transcript. Any mismatch with the local genome sequence is color coded (red for single base variation, blue for single base insertion or deletion). Single nucleotide polymorphisms or errors in the genome sequence appear as a line across multiple cDNAs. The sign 0 at a 5' end indicates a putative cap-site (start of transcription), circles at the 3' end poly A sequences. Some spurious internal priming and other defects in the cDNAs are annotated with a red dot below the sequence (but the flags on the mRNA pink diagram are our best guess at validated 5' and 3' ends). Sequences highlighted in turquoise are the RefSeq NM, pink is the consensus of the cDNAs best matching the genome, pale yellow were submitted on the opposite (probably wrong) strand. More explanations are given in the . Mouse over provides details, clicking even more. Scale is in bases or kilobases (k).
Tissues where expression was observed (from cDNA clones)
GenBank cDNAs whose sequence support the AMOTL2.bAug10 variant (no strict specificity is implied, since some partial sequences might match other variants as well) were found in hippocampus (seen 45 times), brain (44), placenta (37), uterus (21), thalamus (19), cerebellum (18), lung (15), liver (14), embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells (13), eye (13), kidney (11), ovary (10), trachea (9), carcinoid (8), placenta cot 25-normalized (8), breast (7), embryonic stem cells, dmso-treated H9 cellline (7), testis (7), adenocarcinoma (5), adenocarcinoma, cell line (5), hypothalamus (5), liver and spleen (5), melanocyte (5), skin (5), fetal brain (4), fetal pancreas (4 pooled donors, 18 - 20weeks, stratagene #738023) (4), senescent fibroblast (4), amygdala (3), anaplastic oligodendroglioma (3), anaplastic oligodendroglioma with 1p/19qloss (3), bladder (3), embryonic stem cell, retinoic acid andmitogen-treated hes cell line H7 (3), endometrium, adenocarcinoma cell line (3), human placenta (3), knee (3), melanotic melanoma (3), neuroblastoma cot 50-normalized (3), optic nerve (3), osteoarthritic cartilage (3), pancreas (3), pooled germ cell tumors (3), pre-eclamptic placenta (3), prostate (3), total brain (3), transitional cell papilloma, cell line (3), whole brain (3), adipose (2), amnion normal (2), breast carcinoma (2), cartilage (2), cochlea (2), dorsal root ganglia (2), duodenal adenocarcinoma, cell line (2), ear (2), embryonic stem cells, cell lines H1, H7, andh9 (2), fibrosarcoma (2), head neck (2), heart (2), left pelvis (2), nervous normal (2), normal epithelium (2), pooled lung and spleen (2), prostate normal (2), retina (2), serous papillary carcinoma, high grade, 2pooled tumors (2), small intestine (2), synovial membrane tissue from rheumatioidarthritis (2), tongue, tumor tissue (2), well-differentiated endometrialadenocarcinoma, 7 pooled tumors (2), white matter (2), 1st pharyngeal arch (pooled) (once), 2 pooled wilms' tumors, one primary and onemetastatic to brain (once), adrenal gland (once), brain glioblastoma (once), caudate nucleus (once), cervix (once), chondrosarcoma (once), chondrosarcoma grade II (once), chondrosarcoma lung metastasis cell lines (once), colon est (once), colon ins (once), cornea (once), corpus callosum (once), embryonic stem (once), epithelioid carcinoma (once), fetal eye (once), fetal eyes, lens, eye anterior segment,optic nerve, retina, retina foveal and macular, RPE andchoroid (once), head normal (once), hepatoblastoma (once), human skeletal muscle (once), invasive tumor (cell line) (once), lung focal fibrosis (once), melanoma (mewo cell line) (once), metastatic chondrosarcoma (once), moderately-differentiated endometrialadenocarcinoma, 3 pooled tumors (once), occipital scalp hair (once), ovary (pool of 3) (once), pancreatic islet (once), pineal body (once), placenta normal (once), pooled colon, kidney, stomach (once), poorly differentiated adenocarcinoma withsignet ring cell features (once), primary lung epithelial cells (once), retinoblastoma (once), serous papillary tumor (once), spleen (once), squamous cell carcinoma (once), stomach (once), stomach mucosa (once), sympathetic trunk (once), testis normal (once), thymus (once), trabecular meshwork (once), tumor, 5 pooled (see description) (once).
461 selected cDNA clones support this mRNA
This table helps analyze the pattern of expression of the mRNA, the tissue, cell type or disease state specificity of the alternative variants and to select cDNA clones suitable for your experiments.
cDNA accessionLinks to the sequence
Tissuemost 5' clonesin red
From bpto bpin mRNA
From bpto bpin accs.
Clone encodes complete protein(with AA variation)
Anomaliesdetected byAceView
Accessionmatch over(% length)
Base differences relative to genome(% identity)
tiling clone, capped
514/548(93 %)
6 diff(99.0 %id)
eye, retinoblastoma
771/902(85 %)
13 diff(98.6 %id)
hippocampus
540/540(100 %)
0 diff(100 %id)
hippocampus
489/489(100 %)
2 diff(99.6 %id)
brain, fetal brain
816/816(100 %)
13 diff(98.5 %id)
31 to 5014
0 diff(100 %id)
493/493(100 %)
2 diff(99.6 %id)
575/576(99 %)
7 diff(98.8 %id)
cerebellum
547/547(100 %)
1 diff(99.9 %id)
558/558(100 %)
2 diff(99.7 %id)
519/519(100 %)
1 diff(99.9 %id)
570/570(100 %)
2 diff(99.7 %id)
hippocampus
536/536(100 %)
1 diff(99.9 %id)
hippocampus
555/555(100 %)
0 diff(100 %id)
503/503(100 %)
0 diff(100 %id)
579/579(100 %)
6 diff(99.0 %id)
569/569(100 %)
1 diff(99.9 %id)
384/401(95 %)
7 diff(98.3 %id)
590/590(100 %)
0 diff(100 %id)
hippocampus
600/600(100 %)
2 diff(99.7 %id)
cerebellum
550/550(100 %)
1 diff(99.9 %id)
hippocampus
414/421(98 %)
2 diff(99.6 %id)
535/535(100 %)
0 diff(100 %id)
537/537(100 %)
0 diff(100 %id)
hippocampus
also hits gene
485/485(100 %)
1 diff(99.8 %id)
hippocampus
558/558(100 %)
0 diff(100 %id)
hippocampus
596/596(100 %)
2 diff(99.7 %id)
64 to 2929
2 diff(100.0 %id)
cerebellum
565/565(100 %)
1 diff(99.9 %id)
hippocampus
575/575(100 %)
2 diff(99.7 %id)
hippocampus
600/600(100 %)
3 diff(99.5 %id)
617/617(100 %)
0 diff(100 %id)
572/572(100 %)
1 diff(99.9 %id)
569/569(100 %)
2 diff(99.7 %id)
cerebellum
555/555(100 %)
1 diff(99.9 %id)
cerebellum
580/580(100 %)
0 diff(100 %id)
cerebellum
559/559(100 %)
0 diff(100 %id)
cerebellum
543/543(100 %)
0 diff(100 %id)
597/597(100 %)
0 diff(100 %id)
corpus callosum
551/551(100 %)
0 diff(100 %id)
hippocampus
533/533(100 %)
0 diff(100 %id)
hippocampus
574/574(100 %)
0 diff(100 %id)
hippocampus
563/563(100 %)
1 diff(99.9 %id)
hippocampus
576/576(100 %)
3 diff(99.5 %id)
hippocampus
573/573(100 %)
0 diff(100 %id)
563/563(100 %)
2 diff(99.7 %id)
556/556(100 %)
2 diff(99.7 %id)
557/557(100 %)
0 diff(100 %id)
538/538(100 %)
1 diff(99.9 %id)
550/550(100 %)
1 diff(99.9 %id)
588/588(100 %)
0 diff(100 %id)
541/541(100 %)
1 diff(99.9 %id)
584/584(100 %)
1 diff(99.9 %id)
571/571(100 %)
1 diff(99.9 %id)
588/589(99 %)
1 diff(99.9 %id)
hippocampus
473/473(100 %)
1 diff(99.8 %id)
576/576(100 %)
1 diff(99.9 %id)
hippocampus
601/601(100 %)
0 diff(100 %id)
hippocampus
596/596(100 %)
0 diff(100 %id)
584/584(100 %)
0 diff(100 %id)
brain, hippocampus
612/612(100 %)
7 diff(98.9 %id)
Placenta Cot 25-normalized
74 to 1047
966/966(100 %)
9 diff(99.1 %id)
75 to 4488
tiling clone, available from ,
6 diff(99.9 %id)
hippocampus
449/449(100 %)
4 diff(99.2 %id)
566/566(100 %)
4 diff(99.3 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
626/633(98 %)
6 diff(99.1 %id)
743/830(89 %)
18 diff(97.9 %id)
Human Placenta, placenta
716/748(95 %)
19 diff(97.5 %id)
cerebellum
567/567(100 %)
1 diff(99.9 %id)
cerebellum
543/543(100 %)
2 diff(99.7 %id)
cerebellum
539/539(100 %)
1 diff(99.9 %id)
cerebellum
595/596(99 %)
1 diff(99.9 %id)
cerebellum
460/460(100 %)
0 diff(100 %id)
423/423(100 %)
0 diff(100 %id)
561/561(100 %)
1 diff(99.9 %id)
541/541(100 %)
0 diff(100 %id)
576/576(100 %)
0 diff(100 %id)
hippocampus
539/539(100 %)
0 diff(100 %id)
hippocampus
382/382(100 %)
0 diff(100 %id)
hippocampus
587/587(100 %)
0 diff(100 %id)
hippocampus
570/570(100 %)
0 diff(100 %id)
460/460(100 %)
0 diff(100 %id)
555/555(100 %)
0 diff(100 %id)
577/578(99 %)
1 diff(99.9 %id)
531/531(100 %)
0 diff(100 %id)
557/557(100 %)
5 diff(99.2 %id)
546/546(100 %)
1 diff(99.9 %id)
383/383(100 %)
2 diff(99.5 %id)
561/561(100 %)
1 diff(99.9 %id)
546/546(100 %)
0 diff(100 %id)
316/316(100 %)
1 diff(99.7 %id)
481/481(100 %)
0 diff(100 %id)
559/559(100 %)
0 diff(100 %id)
hippocampus
491/491(100 %)
1 diff(99.8 %id)
cerebellum
555/555(100 %)
1 diff(99.9 %id)
cerebellum
543/543(100 %)
0 diff(100 %id)
570/570(100 %)
0 diff(100 %id)
553/553(100 %)
0 diff(100 %id)
557/557(100 %)
0 diff(100 %id)
caudate nucleus
540/540(100 %)
0 diff(100 %id)
hippocampus
559/559(100 %)
3 diff(99.5 %id)
hippocampus
541/541(100 %)
1 diff(99.9 %id)
hippocampus
338/338(100 %)
3 diff(99.2 %id)
hippocampus
490/490(100 %)
2 diff(99.6 %id)
hippocampus
585/585(100 %)
0 diff(100 %id)
hippocampus
597/597(100 %)
2 diff(99.7 %id)
hippocampus
562/562(100 %)
1 diff(99.9 %id)
555/555(100 %)
1 diff(99.9 %id)
569/569(100 %)
1 diff(99.9 %id)
553/553(100 %)
1 diff(99.9 %id)
553/553(100 %)
3 diff(99.5 %id)
546/546(100 %)
3 diff(99.5 %id)
568/568(100 %)
0 diff(100 %id)
459/459(100 %)
1 diff(99.8 %id)
561/561(100 %)
0 diff(100 %id)
534/534(100 %)
1 diff(99.9 %id)
555/555(100 %)
5 diff(99.1 %id)
535/535(100 %)
2 diff(99.7 %id)
547/547(100 %)
1 diff(99.9 %id)
495/495(100 %)
0 diff(100 %id)
fetal brain
655/655(100 %)
6 diff(99.1 %id)
553/553(100 %)
1 diff(99.9 %id)
Human Placenta, placenta
133 to 816
683/711(96 %)
12 diff(98.4 %id)
placenta, pre-eclamptic placenta
140 to 858
723/791(91 %)
18 diff(97.8 %id)
placenta, pre-eclamptic placenta
140 to 907
773/796(97 %)
18 diff(97.8 %id)
Human Placenta, placenta
140 to 906
774/851(90 %)
25 diff(97.1 %id)
hippocampus
141 to 765
623/623(100 %)
2 diff(99.7 %id)
145 to 707
561/561(100 %)
1 diff(99.9 %id)
hippocampus
145 to 691
547/547(100 %)
0 diff(100 %id)
hippocampus
145 to 672
528/528(100 %)
1 diff(99.9 %id)
145 to 686
542/542(100 %)
0 diff(100 %id)
145 to 698
552/552(100 %)
2 diff(99.7 %id)
145 to 609
465/465(100 %)
1 diff(99.8 %id)
145 to 792
646/646(100 %)
1 diff(99.9 %id)
145 to 697
553/553(100 %)
1 diff(99.9 %id)
145 to 669
525/525(100 %)
0 diff(100 %id)
145 to 709
565/565(100 %)
1 diff(99.9 %id)
147 to 2432
available from ,
2 diff(100.0 %id)
148 to 655
508/508(100 %)
0 diff(100 %id)
148 to 698
551/551(100 %)
0 diff(100 %id)
148 to 688
538/538(100 %)
8 diff(98.6 %id)
148 to 681
532/532(100 %)
1 diff(99.9 %id)
149 to 713
565/565(100 %)
0 diff(100 %id)
cerebellum
149 to 706
556/556(100 %)
1 diff(99.9 %id)
cerebellum
149 to 706
556/556(100 %)
1 diff(99.9 %id)
hippocampus
149 to 687
537/537(100 %)
1 diff(99.9 %id)
hippocampus
149 to 708
560/560(100 %)
0 diff(100 %id)
hippocampus
149 to 655
507/507(100 %)
0 diff(100 %id)
hippocampus
149 to 697
547/547(100 %)
1 diff(99.9 %id)
149 to 743
595/595(100 %)
0 diff(100 %id)
tongue, tumor tissue
149 to 727
577/577(100 %)
1 diff(99.9 %id)
149 to 725
576/576(100 %)
2 diff(99.7 %id)
149 to 695
547/547(100 %)
0 diff(100 %id)
149 to 711
566/566(100 %)
4 diff(99.3 %id)
149 to 707
559/559(100 %)
0 diff(100 %id)
149 to 712
564/564(100 %)
0 diff(100 %id)
149 to 706
559/559(100 %)
1 diff(99.9 %id)
149 to 711
563/563(100 %)
0 diff(100 %id)
149 to 705
557/557(100 %)
0 diff(100 %id)
149 to 715
567/567(100 %)
0 diff(100 %id)
149 to 702
554/554(100 %)
0 diff(100 %id)
149 to 715
567/567(100 %)
0 diff(100 %id)
149 to 704
556/556(100 %)
0 diff(100 %id)
149 to 711
563/563(100 %)
0 diff(100 %id)
149 to 723
575/575(100 %)
0 diff(100 %id)
149 to 655
507/507(100 %)
0 diff(100 %id)
149 to 562
414/414(100 %)
1 diff(99.8 %id)
149 to 707
557/557(100 %)
1 diff(99.9 %id)
149 to 711
561/561(100 %)
1 diff(99.9 %id)
149 to 711
561/561(100 %)
1 diff(99.9 %id)
149 to 686
536/536(100 %)
1 diff(99.9 %id)
149 to 711
561/561(100 %)
1 diff(99.9 %id)
149 to 731
581/581(100 %)
1 diff(99.9 %id)
149 to 743
593/593(100 %)
1 diff(99.9 %id)
149 to 713
563/563(100 %)
1 diff(99.9 %id)
149 to 708
558/558(100 %)
1 diff(99.9 %id)
149 to 740
590/590(100 %)
1 diff(99.9 %id)
149 to 406
256/256(100 %)
1 diff(99.7 %id)
149 to 720
570/570(100 %)
1 diff(99.9 %id)
149 to 806
656/656(100 %)
1 diff(99.9 %id)
149 to 730
582/582(100 %)
3 diff(99.5 %id)
synovial membrane tissue from rheumatioidarthritis
149 to 696
546/546(100 %)
1 diff(99.9 %id)
synovial membrane tissue from rheumatioidarthritis
149 to 688
540/540(100 %)
3 diff(99.5 %id)
149 to 684
536/536(100 %)
1 diff(99.9 %id)
149 to 732
582/582(100 %)
4 diff(99.4 %id)
149 to 609
459/459(100 %)
1 diff(99.8 %id)
149 to 698
550/550(100 %)
0 diff(100 %id)
149 to 692
542/542(100 %)
1 diff(99.9 %id)
149 to 722
573/573(100 %)
2 diff(99.7 %id)
149 to 746
596/596(100 %)
1 diff(99.9 %id)
149 to 716
567/567(100 %)
2 diff(99.7 %id)
149 to 708
558/558(100 %)
1 diff(99.9 %id)
149 to 609
462/462(100 %)
2 diff(99.6 %id)
149 to 702
552/552(100 %)
1 diff(99.9 %id)
149 to 717
570/570(100 %)
1 diff(99.9 %id)
hippocampus
150 to 636
485/485(100 %)
7 diff(98.6 %id)
hippocampus
150 to 658
507/509(99 %)
9 diff(98.3 %id)
151 to 673
523/523(100 %)
0 diff(100 %id)
151 to 719
569/569(100 %)
0 diff(100 %id)
151 to 693
543/543(100 %)
0 diff(100 %id)
151 to 695
547/547(100 %)
4 diff(99.3 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
152 to 635
482/482(100 %)
1 diff(99.8 %id)
embryonic stem cell, retinoic acid andmitogen-treated hES cell line H7
152 to 808
655/655(100 %)
2 diff(99.7 %id)
153 to 682
528/528(100 %)
1 diff(99.9 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
155 to 772
616/616(100 %)
2 diff(99.7 %id)
158 to 970
834/1080(77 %)
41 diff(96.3 %id)
Neuroblastoma Cot 50-normalized
164 to 984
814/814(100 %)
14 diff(98.3 %id)
Neuroblastoma Cot 50-normalized
164 to 1257
30 diff(97.3 %id)
pooled lung and spleen
164 to 970
828/1052(78 %)
38 diff(96.4 %id)
placenta, Placenta Cot 25-normalized
165 to 996
830/846(98 %)
25 diff(97.1 %id)
embryonic stem cells, DMSO-treated H9 cellline
167 to 727
561/564(99 %)
6 diff(99.0 %id)
melanotic melanoma, skin
167 to 846
692/914(75 %)
29 diff(96.9 %id)
169 to 740
572/572(100 %)
1 diff(99.9 %id)
hippocampus
173 to 734
562/562(100 %)
2 diff(99.7 %id)
176 to 745
570/570(100 %)
0 diff(100 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
179 to 478
299/299(100 %)
2 diff(99.4 %id)
180 to 739
560/560(100 %)
0 diff(100 %id)
human skeletal muscle
184 to 683
501/501(100 %)
1 diff(99.9 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
324 to 780
460/460(100 %)
5 diff(99.0 %id)
prostate_normal
454 to 683
231/242(95 %)
9 diff(96.3 %id)
prostate_normal
454 to 680
228/243(93 %)
0 diff(100 %id)
580 to 1137
558/562(99 %)
6 diff(99.0 %id)
633 to 1177
545/545(100 %)
1 diff(99.9 %id)
637 to 1193
561/561(100 %)
11 diff(98.1 %id)
embryonic stem cells, DMSO-treated H9 cellline
704 to 1036
333/333(100 %)
0 diff(100 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
801 to 1073
273/273(100 %)
1 diff(99.7 %id)
brain, fetal brain
857 to 1823
957/957(100 %)
10 diff(99.0 %id)
862 to 1167
306/323(94 %)
6 diff(98.2 %id)
902 to 1500
599/599(100 %)
3 diff(99.5 %id)
tongue, tumor tissue
904 to 1469
566/566(100 %)
0 diff(100 %id)
939 to 1165
227/233(97 %)
7 diff(97.0 %id)
980 to 1542
563/563(100 %)
0 diff(100 %id)
988 to 1440
Submitted on the opposite strand
452/476(94 %)
3 diff(99.4 %id)
cerebellum
1043 to 1585
543/543(100 %)
0 diff(100 %id)
anaplastic oligodendroglioma with 1p/19qloss, brain
1045 to 1780
734/977(75 %)
30 diff(97.0 %id)
1050 to 1631
582/582(100 %)
2 diff(99.7 %id)
Placenta Cot 25-normalized
1058 to 1942
884/892(99 %)
16 diff(98.3 %id)
embryonic stem
1081 to 1887
807/807(100 %)
2 diff(99.8 %id)
1100 to 1539
442/449(98 %)
7 diff(98.5 %id)
melanotic melanoma, skin
1203 to 1854
655/955(68 %)
15 diff(98.5 %id)
anaplastic oligodendroglioma with 1p/19qloss, brain
1234 to 1750
535/1049(51 %)
25 diff(97.7 %id)
cerebellum
1237 to 1844
608/608(100 %)
0 diff(100 %id)
1254 to 1879
626/626(100 %)
2 diff(99.7 %id)
1264 to 1872
609/609(100 %)
0 diff(100 %id)
adenocarcinoma, ovary
1298 to 1630
332/332(100 %)
3 diff(99.1 %id)
eye, fetal eye
1300 to 1962
663/663(100 %)
2 diff(99.7 %id)
embryonic stem cells, cell lines H1, H7, andH9
1301 to 1882
581/581(100 %)
1 diff(99.9 %id)
embryonic stem cells, DMSO-treated H9 cellline
1309 to 1709
401/401(100 %)
3 diff(99.3 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
1369 to 2095
727/727(100 %)
2 diff(99.8 %id)
1458 to 2016
559/559(100 %)
0 diff(100 %id)
dorsal root ganglia
1464 to 1984
524/1215(43 %)
23 diff(98.2 %id)
1478 to 1936
459/459(100 %)
1 diff(99.8 %id)
adenocarcinoma, Pancreas
1499 to 2200
available from ,
722/964(74 %)
49 diff(95.0 %id)
Chondrosarcoma Lung Metastasis cell lines, lung
1504 to 2172
665/888(74 %)
11 diff(98.8 %id)
embryonic stem cells, DMSO-treated H9 cellline
1557 to 2150
594/594(100 %)
1 diff(99.9 %id)
placenta, pre-eclamptic placenta
1574 to 1964
395/891(44 %)
16 diff(98.3 %id)
anaplastic oligodendroglioma with 1p/19qloss, brain
1594 to 2199
183 to 795
613/1082(56 %)
47 diff(95.7 %id)
1612 to 4289
tiling clone, available from ,
1 diff(100.0 %id)
1613 to 2332
725/736(98 %)
11 diff(98.6 %id)
1636 to 2239
604/604(100 %)
0 diff(100 %id)
embryonic stem cells, DMSO-treated H9 cellline
1751 to 2567
824/831(99 %)
23 diff(97.3 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
1787 to 2331
545/545(100 %)
1 diff(99.9 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
1793 to 2251
459/459(100 %)
1 diff(99.8 %id)
head_normal
1812 to 2121
311/323(96 %)
3 diff(99.1 %id)
melanotic melanoma, skin
1921 to 2782
865/867(99 %)
12 diff(98.7 %id)
1925 to 2372
Submitted on the opposite strand
446/452(98 %)
0 diff(100 %id)
amnion_normal
1988 to 2257
269/276(97 %)
9 diff(96.8 %id)
placenta_normal
1995 to 2401
431/442(97 %)
35 diff(92.1 %id)
testis_normal
2004 to 2140
137/137(100 %)
4 diff(97.1 %id)
2009 to 2563
555/555(100 %)
8 diff(98.6 %id)
2018 to 2425
411/418(98 %)
9 diff(97.9 %id)
stomach mucosa
2065 to 2646
582/582(100 %)
1 diff(99.9 %id)
adrenal gland
2125 to 2697
573/573(100 %)
2 diff(99.7 %id)
adenocarcinoma, cell line, Liver
2130 to 2905
761/936(81 %)
37 diff(96.1 %id)
hepatoblastoma
2222 to 2820
599/600(99 %)
6 diff(99.0 %id)
2230 to 2524
295/295(100 %)
2 diff(99.4 %id)
2230 to 2680
455/459(99 %)
9 diff(98.1 %id)
2241 to 2808
568/568(100 %)
1 diff(99.9 %id)
occipital scalp hair, skin
2261 to 2429
167/167(100 %)
3 diff(98.3 %id)
2270 to 2840
571/571(100 %)
1 diff(99.9 %id)
brain, total brain
2319 to 2650
347/338(102 %)
59 diff(82.6 %id)
brain, hypothalamus
2352 to 2993
643/643(100 %)
4 diff(99.4 %id)
whole brain
2355 to 2834
493/502(98 %)
39 diff(92.3 %id)
2355 to 2993
640/735(87 %)
7 diff(99.1 %id)
hypothalamus
2358 to 2789
435/435(100 %)
15 diff(96.6 %id)
whole brain
2365 to 2801
446/457(97 %)
25 diff(94.6 %id)
embryonic stem cells, DMSO-treated H9 cellline
2452 to 2948
497/497(100 %)
1 diff(99.8 %id)
Brain glioblastoma
2472 to 3332
861/861(100 %)
9 diff(99.0 %id)
cornea, eye
2571 to 3189
619/619(100 %)
1 diff(99.9 %id)
2587 to 3133
547/547(100 %)
4 diff(99.3 %id)
2596 to 2886
293/293(100 %)
6 diff(98.0 %id)
2673 to 3056
384/384(100 %)
2 diff(99.5 %id)
dorsal root ganglia
2700 to 3346
653/976(66 %)
6 diff(99.4 %id)
2704 to 3571
877/906(96 %)
22 diff(97.6 %id)
Placenta Cot 25-normalized
2715 to 4453
tiling clone,
0 diff(100 %id)
placenta, Placenta Cot 25-normalized
2715 to 3572
fully sequenced,
854/854(100 %)
4 diff(99.6 %id)
2719 to 3321
603/603(100 %)
2 diff(99.7 %id)
2719 to 3315
597/597(100 %)
2 diff(99.7 %id)
duodenal adenocarcinoma, cell line, small intestine
2721 to 3481
758/958(79 %)
14 diff(98.6 %id)
duodenal adenocarcinoma, cell line, small intestine
2722 to 3443
717/892(80 %)
14 diff(98.5 %id)
White Matter
2734 to 3278
545/910(59 %)
6 diff(99.4 %id)
2741 to 3527
796/807(98 %)
17 diff(97.9 %id)
2743 to 3315
573/573(100 %)
2 diff(99.7 %id)
embryonic stem cells, DMSO-treated H9 cellline
2756 to 3302
547/547(100 %)
5 diff(99.1 %id)
amnion_normal
2759 to 3198
440/453(97 %)
4 diff(99.2 %id)
pooled lung and spleen
2766 to 3837
14 to 1094
6 diff(99.5 %id)
endometrium, adenocarcinoma cell line, uterus
2775 to 3390
620/623(99 %)
11 diff(98.3 %id)
endometrium, adenocarcinoma cell line, uterus
2776 to 3389
619/657(94 %)
31 diff(95.3 %id)
endometrium, adenocarcinoma cell line, uterus
2776 to 3423
642/704(91 %)
14 diff(98.1 %id)
2782 to 3356
575/575(100 %)
2 diff(99.7 %id)
2783 to 3071
288/288(100 %)
2 diff(99.4 %id)
2836 to 3604
768/802(95 %)
4 diff(99.6 %id)
2837 to 3604
767/768(99 %)
4 diff(99.5 %id)
2856 to 3272
421/431(97 %)
8 diff(98.2 %id)
2878 to 3213
337/346(97 %)
8 diff(97.7 %id)
adenocarcinoma, cell line, Liver
2932 to 3663
723/924(78 %)
16 diff(98.3 %id)
epithelioid carcinoma, Pancreas
2932 to 3319
391/940(41 %)
5 diff(99.5 %id)
adenocarcinoma, ovary
2936 to 3681
738/884(83 %)
28 diff(96.9 %id)
eye, optic nerve
2936 to 3655
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
719/719(100 %)
6 diff(99.2 %id)
adenocarcinoma, ovary
2949 to 3687
748/749(99 %)
42 diff(94.4 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
2950 to 3533
585/620(94 %)
6 diff(99.1 %id)
2973 to 3263
175 to 465
291/466(62 %)
3 diff(99.4 %id)
2974 to 3148
175/175(100 %)
0 diff(100 %id)
pooled colon, kidney, stomach
3021 to 3774
753/757(99 %)
6 diff(99.3 %id)
3021 to 3774
753/784(96 %)
6 diff(99.3 %id)
3024 to 3911
895/956(93 %)
42 diff(95.7 %id)
3040 to 3202
163/163(100 %)
1 diff(99.4 %id)
skin, squamous cell carcinoma
3083 to 3852
769/770(99 %)
5 diff(99.4 %id)
3107 to 3384
278/294(94 %)
6 diff(98.0 %id)
embryonic stem cell, retinoic acid andmitogen-treated hES cell line H7
3131 to 3876
746/746(100 %)
1 diff(99.9 %id)
Placenta Cot 25-normalized
3151 to 3644
498/948(52 %)
15 diff(98.5 %id)
nervous_normal
3152 to 3483
332/383(86 %)
1 diff(99.8 %id)
adenocarcinoma, ovary
3176 to 3752
595/835(71 %)
32 diff(96.2 %id)
White Matter
3188 to 4047
870/887(98 %)
15 diff(98.4 %id)
mixed (pool of 40 RNAs)
3193 to 3740
554/981(56 %)
11 diff(98.9 %id)
3197 to 3439
241/250(96 %)
12 diff(95.2 %id)
adenocarcinoma, cell line, Liver
3220 to 4018
792/959(82 %)
24 diff(97.5 %id)
3222 to 3707
506/521(97 %)
41 diff(92.2 %id)
3224 to 3694
471/472(99 %)
2 diff(99.6 %id)
3235 to 3565
334/334(100 %)
4 diff(98.9 %id)
liver and spleen
3337 to 3707
376/445(84 %)
7 diff(98.5 %id)
liver and spleen
3337 to 3685
354/451(78 %)
9 diff(98.1 %id)
bladder, transitional cell papilloma, cell line
3346 to 4144
789/885(89 %)
48 diff(94.6 %id)
bladder, transitional cell papilloma, cell line
3347 to 4056
695/904(76 %)
23 diff(97.5 %id)
3368 to 3721
354/354(100 %)
0 diff(100 %id)
3394 to 3996
110 to 723
614/1192(51 %)
19 diff(98.5 %id)
sympathetic trunk
3397 to 4214
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
826/826(100 %)
16 diff(98.1 %id)
melanocyte
3409 to 3857
451/452(99 %)
5 diff(98.9 %id)
3426 to 3995
572/576(99 %)
6 diff(99.0 %id)
embryonic stem cells, cell lines H1, H7, andH9
3441 to 4160
720/720(100 %)
10 diff(98.7 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
3451 to 4065
616/635(97 %)
6 diff(99.1 %id)
placenta, Placenta Cot 25-normalized
3469 to 4453
984/1072(91 %)
17 diff(98.5 %id)
senescent fibroblast
3478 to 3846
fully sequenced,
377/377(100 %)
7 diff(98.2 %id)
3506 to 4056
550/550(100 %)
1 diff(99.9 %id)
Chondrosarcoma, Left Pelvis
3509 to 4232
723/723(100 %)
3 diff(99.6 %id)
ovary (pool of 3)
3529 to 4530
21 to 1029
33 diff(97.2 %id)
breast carcinoma
3537 to 3631
99/99(100 %)
8 diff(92.0 %id)
placenta, Placenta Cot 25-normalized
3542 to 4453
fully sequenced,
904/904(100 %)
9 diff(99.1 %id)
embryonic stem cell, retinoic acid andmitogen-treated hES cell line H7
3557 to 4265
712/712(100 %)
7 diff(99.1 %id)
3570 to 3823
254/255(99 %)
2 diff(99.3 %id)
brain, fetal brain
3582 to 4485
also hits gene
905/905(100 %)
8 diff(99.2 %id)
melanoma (MeWo cell line)
3611 to 4237
627/627(100 %)
2 diff(99.7 %id)
brain, hypothalamus
3632 to 4255
627/627(100 %)
9 diff(98.6 %id)
brain, hypothalamus
3632 to 4312
683/683(100 %)
28 diff(96.0 %id)
3636 to 4214
572/586(97 %)
29 diff(95.1 %id)
Neuroblastoma Cot 50-normalized
3655 to 4239
592/597(99 %)
0 diff(100 %id)
carcinoid, lung
3664 to 4139
476/479(99 %)
0 diff(100 %id)
3683 to 4024
352/360(97 %)
17 diff(95.3 %id)
carcinoid, lung
3684 to 4139
456/459(99 %)
0 diff(100 %id)
carcinoid, lung
3696 to 4136
441/441(100 %)
0 diff(100 %id)
anaplastic oligodendroglioma, brain
3697 to 4157
461/461(100 %)
1 diff(99.8 %id)
3707 to 4488
776/943(82 %)
8 diff(99.2 %id)
carcinoid, lung
3718 to 4139
422/425(99 %)
0 diff(100 %id)
eye, optic nerve
3721 to 4310
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
589/589(100 %)
2 diff(99.7 %id)
nervous_normal
3727 to 3916
189/217(87 %)
6 diff(97.3 %id)
Fetal Pancreas (4 Pooled Donors, 18 - 20weeks, Stratagene #738023)
3731 to 4207
477/477(100 %)
3 diff(99.4 %id)
3742 to 4214
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
473/475(99 %)
11 diff(97.7 %id)
carcinoid, lung
3744 to 4214
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
470/470(100 %)
8 diff(98.3 %id)
3748 to 4489
743/743(100 %)
4 diff(99.5 %id)
3748 to 4289
540/540(100 %)
8 diff(98.6 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
3749 to 4338
589/599(98 %)
6 diff(99.0 %id)
adenocarcinoma, cell line, Liver
3749 to 4489
742/742(100 %)
4 diff(99.5 %id)
3767 to 4219
454/456(99 %)
0 diff(100 %id)
Knee, Osteoarthritic Cartilage
3767 to 4488
721/721(100 %)
4 diff(99.5 %id)
senescent fibroblast
3768 to 4219
451/452(99 %)
0 diff(100 %id)
3768 to 4207
440/441(99 %)
0 diff(100 %id)
carcinoid, lung
3768 to 4211
443/446(99 %)
0 diff(100 %id)
Fibrosarcoma
3768 to 4488
718/718(100 %)
4 diff(99.5 %id)
anaplastic oligodendroglioma, brain
3769 to 4214
Possibly primed on the genome, locally A rich (11/12 A in genome downstream of last aligned base)
446/446(100 %)
2 diff(99.6 %id)
liver and spleen
3777 to 4146
378/378(100 %)
14 diff(96.3 %id)
3781 to 4242
462/1085(42 %)
0 diff(100 %id)
lung, Metastatic Chondrosarcoma
3781 to 4232
452/460(98 %)
2 diff(99.6 %id)
3786 to 4226
441/443(99 %)
0 diff(100 %id)
3786 to 4488
703/703(100 %)
0 diff(100 %id)
melanocyte
3796 to 4220
430/430(100 %)
7 diff(98.4 %id)
3800 to 4230
436/438(99 %)
10 diff(97.8 %id)
3800 to 4481
682/955(71 %)
0 diff(100 %id)
Fetal Pancreas (4 Pooled Donors, 18 - 20weeks, Stratagene #738023)
3801 to 4295
495/495(100 %)
1 diff(99.8 %id)
anaplastic oligodendroglioma, brain
3804 to 4219
416/418(99 %)
0 diff(100 %id)
Fetal Pancreas (4 Pooled Donors, 18 - 20weeks, Stratagene #738023)
3809 to 4438
630/645(97 %)
6 diff(99.1 %id)
melanocyte
3810 to 4220
425/431(98 %)
17 diff(96.1 %id)
Fibrosarcoma
3810 to 4488
678/678(100 %)
1 diff(99.9 %id)
senescent fibroblast
3816 to 4220
fully sequenced,
405/405(100 %)
2 diff(99.6 %id)
Knee, Osteoarthritic Cartilage
3824 to 4488
665/665(100 %)
1 diff(99.9 %id)
liver and spleen
3833 to 4214
381/381(100 %)
3 diff(99.3 %id)
eye, retina
3835 to 4238
fully sequenced,
407/407(100 %)
6 diff(98.6 %id)
liver and spleen
3839 to 4211
377/377(100 %)
7 diff(98.2 %id)
lung, Primary Lung Epithelial Cells
3839 to 4485
647/647(100 %)
0 diff(100 %id)
eye, optic nerve
3841 to 4485
643/643(100 %)
2 diff(99.7 %id)
3850 to 4108
259/274(94 %)
6 diff(97.9 %id)
Chondrosarcoma Grade II, Left Pelvis
3853 to 4488
636/636(100 %)
0 diff(100 %id)
lung, Lung Focal Fibrosis
3870 to 4488
617/617(100 %)
1 diff(99.9 %id)
3890 to 4220
331/331(100 %)
0 diff(100 %id)
breast carcinoma
3906 to 4006
102/102(100 %)
1 diff(99.1 %id)
eye, Trabecular meshwork
3915 to 4292
379/379(100 %)
11 diff(97.1 %id)
3925 to 4153
229/230(99 %)
0 diff(100 %id)
pooled germ cell tumors
3947 to 4220
274/274(100 %)
0 diff(100 %id)
pooled germ cell tumors
3947 to 4220
274/274(100 %)
0 diff(100 %id)
senescent fibroblast
3948 to 4489
543/547(99 %)
0 diff(100 %id)
Fetal Pancreas (4 Pooled Donors, 18 - 20weeks, Stratagene #738023)
3949 to 4488
540/540(100 %)
3 diff(99.5 %id)
embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells
3949 to 4494
546/560(97 %)
6 diff(99.0 %id)
3951 to 4245
fully sequenced,
312/312(100 %)
8 diff(97.5 %id)
3953 to 4481
529/529(100 %)
1 diff(99.9 %id)
3954 to 4040
87/87(100 %)
0 diff(100 %id)
3956 to 4489
534/535(99 %)
0 diff(100 %id)
carcinoid, lung
3956 to 4489
535/537(99 %)
0 diff(100 %id)
brain, total brain
3962 to 4212
251/253(99 %)
0 diff(100 %id)
serous papillary carcinoma, high grade, 2pooled tumors, uterus
3975 to 4219
246/249(98 %)
0 diff(100 %id)
3981 to 4291
140 to 452
313/452(69 %)
6 diff(98.7 %id)
normal epithelium, ovary
3983 to 4481
499/499(100 %)
0 diff(100 %id)
poorly differentiated adenocarcinoma withsignet ring cell features, stomach
3986 to 4220
234/234(100 %)
1 diff(99.6 %id)
eye, fetal eyes, lens, eye anterior segment,optic nerve, retina, Retina Foveal and Macular, RPE andChoroid
3991 to 4498
tiling clone, AAA
Possibly primed on the genome, locally A rich (9/9 A in genome downstream of last aligned base)
509/509(100 %)
1 diff(99.9 %id)
bladder, transitional cell papilloma, cell line
4002 to 4488
488/488(100 %)
3 diff(99.4 %id)
4011 to 4167
fully sequenced, AAA
159/159(100 %)
0 diff(100 %id)
4015 to 4218
204/204(100 %)
0 diff(100 %id)
melanocyte
4017 to 4323
305/306(99 %)
6 diff(98.1 %id)
serous papillary carcinoma, high grade, 2pooled tumors, uterus
4020 to 4482
458/530(86 %)
26 diff(95.1 %id)
ovary, tumor, 5 pooled (see description)
4023 to 4463
441/441(100 %)
0 diff(100 %id)
4025 to 4489
464/465(99 %)
0 diff(100 %id)
1st pharyngeal arch (pooled)
4028 to 4238
209/228(91 %)
5 diff(97.9 %id)
uterus, well-differentiated endometrialadenocarcinoma, 7 pooled tumors
4046 to 4489
444/444(100 %)
0 diff(100 %id)
4047 to 4452
407/407(100 %)
10 diff(97.6 %id)
melanocyte
4047 to 4488
445/445(100 %)
7 diff(98.5 %id)
Knee, Osteoarthritic Cartilage
4053 to 4467
Possibly primed on the genome, locally A rich (9/9 A in genome downstream of last aligned base)
415/415(100 %)
0 diff(100 %id)
4055 to 4249
192/226(84 %)
9 diff(96.1 %id)
4057 to 4488
432/432(100 %)
3 diff(99.4 %id)
ovary, serous papillary tumor
4057 to 4489
433/434(99 %)
0 diff(100 %id)
hippocampus
4059 to 4488
Submitted on the opposite strand
432/432(100 %)
6 diff(98.7 %id)
pooled germ cell tumors
4060 to 4488
429/429(100 %)
1 diff(99.8 %id)
4060 to 4488
533 to 103
431/431(100 %)
6 diff(98.7 %id)
hypothalamus
4066 to 4487
Submitted on the opposite strand
422/422(100 %)
0 diff(100 %id)
whole brain
4074 to 4481
407/407(100 %)
12 diff(97.1 %id)
uterus, well-differentiated endometrialadenocarcinoma, 7 pooled tumors
4081 to 4489
409/415(98 %)
0 diff(100 %id)
4086 to 4489
409/419(97 %)
0 diff(100 %id)
4104 to 4489
402/411(97 %)
0 diff(100 %id)
4105 to 4488
383/383(100 %)
1 diff(99.8 %id)
adenocarcinoma, cell line, Liver
4115 to 4485
371/581(63 %)
4 diff(99.4 %id)
4115 to 4485
371/581(63 %)
4 diff(99.4 %id)
moderately-differentiated endometrialadenocarcinoma, 3 pooled tumors, uterus
4132 to 4482
351/351(100 %)
12 diff(96.6 %id)
4137 to 4483
fully sequenced,
354/354(100 %)
5 diff(98.6 %id)
4140 to 4489
351/353(99 %)
0 diff(100 %id)
4141 to 4486
346/350(98 %)
0 diff(100 %id)
Pancreas, pancreatic islet
4155 to 4481
326/326(100 %)
2 diff(99.4 %id)
2 pooled Wilms' tumors, one primary and onemetastatic to brain, Kidney
4170 to 4482
312/312(100 %)
2 diff(99.4 %id)
eye, retina
4208 to 4466
fully sequenced,
263/263(100 %)
4 diff(98.5 %id)
4215 to 4476
fully sequenced,
263/263(100 %)
4 diff(98.5 %id)
4230 to 4489
259/262(98 %)
0 diff(100 %id)
cochlea, ear
4233 to 4467
fully sequenced, AAA
Possibly primed on the genome, locally A rich (9/9 A in genome downstream of last aligned base)
235/235(100 %)
6 diff(97.5 %id)
pineal body
4246 to 4488
243/243(100 %)
0 diff(100 %id)
invasive tumor (cell line), Prostate
4250 to 4390
141/141(100 %)
1 diff(99.3 %id)
4267 to 4488
222/222(100 %)
0 diff(100 %id)
brain, total brain
4271 to 4481
209/209(100 %)
2 diff(99.1 %id)
cochlea, ear
4278 to 4481
fully sequenced, AAA
Possibly primed on the genome, locally A rich (9/9 A in genome downstream of last aligned base)
204/204(100 %)
0 diff(100 %id)
4434 to 4667
fully sequenced,
235/235(100 %)
3 diff(98.8 %id)
4455 to 5014
563/568(99 %)
9 diff(98.5 %id)
4469 to 4807
tiling clone, fully sequenced,
343/343(100 %)
2 diff(99.5 %id)
hippocampus
4518 to 5014
Submitted on the opposite strand
498/498(100 %)
2 diff(99.6 %id)
carcinoid, lung
4586 to 5017
tiling clone,
432/432(100 %)
0 diff(100 %id)
4637 to 5014
fully sequenced,
376/376(100 %)
2 diff(99.5 %id)
4777 to 5014
fully sequenced,
246/246(100 %)
0 diff(100 %id)
normal epithelium, ovary
4782 to 5014
233/233(100 %)
2 diff(99.2 %id)
4814 to 5014
201/201(100 %)
2 diff(99.1 %id)
4910 to 4992
Possibly primed on the genome, locally A rich (9/9 A in genome downstream of last aligned base)
83/83(100 %)
3 diff(96.4 %id)
All sequences, including the mRNA, the premessenger or transcription unit, the 5 kb upstream and the UTRs are clickable and link to their DNA content, individual introns and exons sequences are given
mRNA variant
mRNA matching the genome
Best predicted protein
Upstream sequence
Transcriptionunitpre-mRNA
Downstream sequence
>Conceptual protein AMOTL2.bAug10, 787 aa, with exons in alternate blue green colors and red amino acids encoded at junctions
MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGTGGTGS
PQASLEILAPEDSQVLQQATRQEPQGQEHQGGENHLAENTLYRLCPQPSK
GEELPTYEEAKAHSQYYAAQQAGTRPHAGDRDPRGAPGGSRRQDEALREL
RHGHVRSLSERLLQLSLERNGARAPSHMSSSHSFPQLARNQQGPPLRGPP
AEGPESRGPPPQYPHVVLAHETTTAVTDPRYRARGSPHFQHAEVRILQAQ
VPPVFLQQQQQYQYLQQSQEHPPPPHPAALGHGPLSSLSPPAVEGPVSAQ
ASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLES
EIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLES
ANRRLASKTQEAQAGSQDMVAKLLAQSYEQQQEQEKLEREMALLRGAIED
QRRRAELLEQALGNAQGRAARAEEELRKKQAYVEKVERLQQALGQLQAAC
EKREQLELRLRTRLEQELKALRAQQRQAGAPGGSSGSGGSPELSALRLSE
QLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIR
HSPQPSPSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRS
RRDPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLT
TADRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLL
GCSSSQRAASLDSVATSRVQDLSDMVEILI.*
>mRNA AMOTL2.bAug10, 5017 bp with coding in upper case and exons in alternate colors
cggagggcggaggagggcggtgcgctgagaggttatttgtggttcgctttgatcccgagggggaacctgaaactctcacattcctggcatagcagccgcc
tccggcgcgggccgaccctggggctgcgcgctggggcgcgaacagccagagcgtcggcgccacggccgagaacacatcttcgccgccgagctgagctggg
ccgagccggaggttgtggtgtctgactgcgctgggcaccctcgggccgcagcggtgctctggggccaggtgccaccggccattgtccaggcagctgtgtg
caagccaaagaagcATGAGGACACTGGAAGACTCCTCGGGGACAGTCCTGCACCGCCTCATCCAGGAGCAGCTGCGCTACGGCAACCTGACTGAGACGCG
CACGCTGCTAGCCATCCAGCAGCAGGCCCTGAGGGGTGGGGCTGGAACTGGGGGTACAGGGAGCCCCCAGGCCTCCCTGGAGATCCTGGCCCCAGAGGAC
AGTCAGGTGCTGCAGCAGGCCACCAGGCAGGAGCCCCAGGGCCAGGAGCACCAGGGCGGTGAGAACCACCTGGCAGAGAACACCCTCTACCGGCTATGCC
CACAGCCCAGCAAGGGAGAGGAGCTGCCCACCTATGAGGAGGCCAAAGCCCACTCGCAGTACTATGCGGCCCAGCAGGCAGGGACCCGGCCACATGCGGG
GGACCGAGATCCCCGTGGGGCCCCGGGAGGCAGTCGGAGGCAGGACGAGGCCCTGCGGGAGCTGAGGCATGGGCACGTGCGCTCGTTGAGTGAACGGCTC
CTTCAGTTGTCCCTGGAGAGGAACGGCGCCCGGGCCCCCAGCCACATGAGCTCCTCCCACAGCTTCCCACAGCTGGCCCGCAACCAGCAGGGCCCCCCAC
TGAGGGGCCCCCCTGCTGAGGGCCCAGAGTCCCGAGGACCCCCACCTCAGTACCCTCATGTTGTACTAGCTCATGAGACCACCACTGCTGTCACTGACCC
ACGGTACCGTGCCCGCGGCAGCCCGCACTTCCAGCATGCTGAAGTCAGGATCCTGCAGGCCCAGGTGCCTCCTGTGTTCCTCCAACAGCAGCAGCAGTAC
CAGTACCTGCAGCAATCTCAGGAGCACCCCCCTCCCCCACATCCAGCTGCTCTCGGCCATGGCCCCCTGAGCTCCCTCAGTCCACCTGCTGTGGAGGGGC
CAGTGAGTGCCCAGGCCTCCTCAGCCACCTCGGGCAGTGCCCACCTGGCCCAGATGGAGGCCGTGCTGAGGGAGAATGCCAGGCTGCAGAGAGACAATGA
GCGGCTGCAGAGGGAGCTGGAGAGCTCTGCGGAGAAGGCTGGCCGCATTGAGAAGCTGGAAAGCGAAATCCAGCGGCTCTCTGAGGCCCATGAGAGCCTG
ACCAGAGCCTCCTCCAAGCGTGAGGCCCTGGAGAAGACCATGCGGAACAAGATGGACAGTGAAATGAGGAGGCTGCAAGACTTCAACCGGGATCTTAGAG
AGAGATTGGAATCTGCAAATCGCCGCCTGGCAAGCAAGACACAGGAGGCCCAGGCCGGCAGTCAGGACATGGTGGCCAAGCTGCTTGCTCAGAGCTACGA
ACAGCAGCAGGAGCAAGAGAAGCTGGAGCGAGAGATGGCACTGCTGCGCGGCGCCATCGAGGACCAGCGGCGGCGTGCCGAGCTGCTGGAGCAGGCTCTG
GGCAATGCGCAGGGCCGGGCAGCTCGAGCCGAAGAGGAGCTGCGCAAGAAGCAGGCCTATGTGGAGAAAGTGGAGCGGCTGCAGCAGGCGCTCGGGCAGC
TGCAGGCAGCCTGTGAGAAGCGGGAGCAGCTGGAGCTGCGTCTGCGGACTCGCCTGGAGCAGGAACTCAAGGCCCTGCGTGCACAGCAGAGACAGGCAGG
TGCCCCAGGTGGTAGCAGTGGCAGTGGTGGGTCTCCAGAGCTCAGCGCCCTGCGACTGTCAGAACAACTGCGAGAGAAGGAGGAGCAGATCCTGGCGCTG
GAGGCCGACATGACCAAGTGGGAGCAGAAGTATTTGGAGGAACGTGCCATGAGGCAGTTTGCCATGGATGCGGCTGCCACGGCTGCTGCTCAGCGTGACA
CCACTCTCATCCGACATTCCCCCCAGCCCTCACCCAGCAGCAGCTTCAATGAGGGTCTGCTCACTGGTGGCCACAGGCATCAGGAGATGGAAAGCAGGTT
AAAGGTGCTCCATGCCCAGATCCTGGAGAAGGATGCAGTGATCAAGGTCCTTCAGCAGCGCTCCAGGAGAGACCCTGGCAAGGCCATCCAGGGCTCCCTG
CGGCCTGCCAAGTCGGTGCCATCTGTTTTCGCGGCTGCGGCAGCAGGAACCCAGGGCTGGCAAGGGCTCTCTTCTAGTGAGCGACAAACAGCAGACGCCC
CTGCTCGGCTGACTACAGCAGACAGAGCACCCACAGAGGAGCCAGTGGTCACAGCTCCCCCTGCTGCCCATGCCAAACACGGGAGCAGAGATGGGAGCAC
CCAGACTGAGGGCCCCCCAGACAGCACCTCCACCTGCCTGCCACCGGAGCCTGACAGCCTTCTGGGGTGCAGCAGTAGCCAGAGAGCAGCCTCTCTGGAC
TCTGTAGCTACATCCAGAGTCCAGGACTTGTCAGACATGGTGGAGATACTGATCTGAaggaggtggtgcttcaggactctgagccattctctcccctcct
ctgccctgtgccactctcagccatttcagcagccccgtcaaccgctgctccgtccctttccccagccagacactcattcccattgaccatctggtcccag
gagctcaggaggaggaccccaggggagaggagagctgtgagagcaccggcacccccagaagactctgcttcttagcccacattcctccgggccttatgga
gaatgaggattcagccttgacttcttgcccaaggcctgctactggggtagcaactgacagctcagaaaggagctgagctccctctgccctgccagttgtc
agtcaggcagggagggagtggctgtgttggtttggggaactaatttccacggacggctgcccgtggacaccaggtggactggttcactaatcaagtcagc
catattgttctctggctaagtttggttccagccaacgtcatctgctcttcagttcctcactgccttcttgggatactaagacttgaattttttggggact
attaagggtgttagtcttggagaagacacagcctcaccttctcacttgctgtgggtgaggggccatttaagtggactgggagacagtgcgcagtttgtat
ataattccctttcttgtggaacagaagactgaggcctgcaggttccgatgtgtctccatgggctgtgctcccctcttcctactgtcagtttctgaaactt
ctgactggcctcccagttatgcctcctcctcaagttcctggcccgtggatgttaaagctgctcgattcccaggatctcggctgccttttcctctatcttg
agccctataaatgcccacgggacccccaccaccagcctcttgaagtggctccacagctcctgtccctggaacatcctgtcagtttggtcataaaccctga
gccagatgaaatgagccaccgtgaacagacatctgccatgcccccaggtgggcttcggtggccctacccggtaccagttctttctgagaaactggagatg
tcttgttagcataagtgtcttcattcccacctggagggtttgggagaggagcaaagcagttgaaaactagttaatgagctacaagagtcaaatagtcctc
tgaatggagcccccatcacaaaacagtgcccaggaggctggctcctcaagctacccatgcccagcgccctaaagcagcaccagatgctttggaattgggg
tgaaacacccacatggcagcctgctagcagcagtgactttgacttctggtcttaaagagtccctcacttcagccccaggagctattggtgggttttagca
gttttgtctttaccgtttttagttctccttgattctttgttttcttcctttatcgtttttaggtttggtatgtgttgttttatttccatggttcctcaag
tttcctttttaaacatttgcatttgctggacaattgcaattttttttaaaaaattcccctacccctgtttaaagctgaaaaatacatttggttcatgtgc
attgtttacaaagcaaaaagaaaaaagaggaaaaaaaggcaaaaaatattgtgaaagaaaaaaaacaacttaatatattttggattaatatttggtattt
cttttaaagtattttttgtgctgtgaacattttctgccaaagaccatgatgtgtgtctgtatgtttaagttatcgtaaatatttaaaatgtaaacatggc
tgttttgttatgccaccctgtaccaggattgctgccgcattccactgggtataacagtattttaattaaaaaaaaataattaaaagtgatgtctttgcac
aggtgagactttgcactgagggaagggaaagggtgaggattttggggggccacccaagtcatagtccaatctcttcaaggacccaagatagaatttagga
attttgtgaagctgcattaaggatagagttggaatgaggatgtggctggcatttttcccctttcatagataacatttcttgaaggctgggaggggaagga
gggcctggcagatggcagcctcccgaggtagggctgtgttctaatcagctttgttcggccacacgctgtggttatccacagtgggagtgggtgtccaaag
atggctttatccttcccccactccttttcccactcccacctagcacataaagttttgtccgaaaccatccagaaggccaggcaccatgcagaggacattc
aagaatgtgcatgttcttagccaccgcctccctcctttgctgtgacatcaccactctttcctgatgctcaggaaagcatattgctccaattcaaaattaa
agaaagccattctcagt
mRNA variant
# of clones
From tissue (no strict specificity is implied)
5' completeness evidence
3' completeness evidence
coordinateson gene
coordinateson genome
hippocampus (45), brain (43), placenta (33), uterus (20) and 112 other
validated polyA
886 to20135
contains . It is defined by cap selected clones. There is an in frame stop in the 5'UTR 123 bp before the Met.
followed by the polyA. The standard AATAAA polyadenylation signal does not occur, but the variant ATTAAA is seen about 22 bp before the polyA.
Validated poly A sites
Position on the gene
Position on the mRNA
Number of supporting accessions
Poly-A signal
Distance to poly-A site
bp 4488 on .b
Proteinquality
Exonsin CDS
Completenessand uniqueness
Extends from
coordinateson mRNA
minimal set ofsupporting clones
second peroximal domaincoiled coil stretch
Met (ATG) to Stop
315 to 2657
Sequences of exons and introns are available by clicking on the lengths in column 3. Red corresponds to exons or introns specific of mRNA variant bAug10.
in variant
Length& DNA
Coordinateson mRNA
Coordinateson gene
Coordinateson genome
Supportingclones
From tissue (# clones)
Alternative exon 1
886 to 1138
amygdala (1)
Alternative intron 1 [gt-ag]
253 to 254
1139 to 3985
hippocampus (43), brain (30), placenta (24), thalamus (18) and 31 other tissues
Alternative exon 2
254 to 1048
3986 to 4780
brain (1), kidney (1), neuroblastoma cot 50-normalized (1), placenta (1)
Alternative intron 2 [gt-ag]
1048 to 1049
4781 to 7676
brain (2), brain, anaplastic oligodendroglioma with1p/19q loss (1), cartilage (1), cerebellum (1) and 13 other tissues
Alternative exon 3
1049 to 1355
7677 to 7983
brain (2), brain, anaplastic oligodendroglioma with1p/19q loss (1), cerebellum (1), colon ins (1) and 7 other tissues
Alternative intron 3 [gt-ag]
1355 to 1356
7984 to 9052
brain (4), anaplastic oligodendroglioma with 1p/19qloss (2), cerebellum (2), eye (2) and 22 other tissues
Alternative exon 4
1356 to 1500
9053 to 9197
brain (4), anaplastic oligodendroglioma with 1p/19qloss (2), cerebellum (2), eye (2) and 20 other tissues
Intron 4 [gt-ag]
1500 to 1501
9198 to 9570
brain (6), anaplastic oligodendroglioma with 1p/19qloss (2), cerebellum (2), eye (2) and 24 other tissues
1501 to 1593
9571 to 9663
brain (5), anaplastic oligodendroglioma with 1p/19qloss (2), eye (2), lung (2) and 23 other tissues
Alternative intron 5 [gt-ag]
1593 to 1594
9664 to 13672
brain (5), lung (3), placenta (3), adenocarcinoma (2) and 26 other tissues
Alternative exon 6
1594 to 1889
13673 to 13968
brain (3), placenta (2), adenocarcinoma (1), adipose (1) and 17 other tissues
Alternative intron 6 [gt-ag]
1889 to 1890
13969 to 15066
brain (3), embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells (3), embryonic stem cells, dmso-treated H9 cellline (2), eye (2) and 17 other tissues
Alternative exon 7
1890 to 2197
15067 to 15374
brain (2), embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells (2), brain, anaplastic oligodendroglioma with1p/19q loss (1), embryonic stem cells, dmso-treated H9 cellline (1) and 6 other tissues
Alternative intron 7 [gt-ag]
2197 to 2198
15375 to 15976
brain (3), embryonic stem cells, embryoid bodiesderived from H1, H7 and H9 cells (2), adenocarcinoma, cell line (1), adrenal gland (1) and 17 other tissues
Alternative exon 8
2198 to 2418
15977 to 16197
brain (3), adenocarcinoma, cell line (1), adrenal gland (1), brain, anaplastic oligodendroglioma with1p/19q loss (1) and 13 other tissues
Alternative intron 8 [gt-ag]
2418 to 2419
16198 to 16760
brain (3), embryonic stem cells, dmso-treated H9 cellline (2), hypothalamus (2), skin (2) and 13 other tissues
Alternative exon 9
2419 to 2598
16761 to 16940
brain (3), hypothalamus (2), whole brain (2), adenocarcinoma, cell line (1) and 10 other tissues
Alternative intron 9 [gt-ag]
2598 to 2599
16941 to 17716
brain (4), embryonic stem cells, dmso-treated H9 cellline (2), hypothalamus (2), whole brain (2) and 20 other tissues
Alternative exon 10
2599 to 5017
17717 to 20135
The protein sequence is predicted from the mRNA confirmation of the protein's existence and extent will require more protein sequence data.
The complete protein encoded between the first Met (atg) and the stop codon contains
residues. The calculated molecular weight of the protein is 85.8 kDa, its isoelectric point 7.6.
PSORT II analysis, (K. Nakai) trained on yeast data predicts that the subcellular location of this protein is most likely in the nucleus (65%). Less likely possibilities are in the cytoplasm (17%) or in the mitochondria (8%) or in vesicles of the secretory system (4%) or in the endoplasmic reticulum (4%).
The following domains were found:
306 to 571
GSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMVAKLLAQSYEQQQE...
488 to 496
Pfam analysis () run on Feb 04, 2011, shows that this protein does not belong to any recognized protein family.
BlastP analysis was run at
against the nr database on Feb 04, 2011, and identified 259 hits with E value better than 0.001. The best hits are.
from aa to aa
blastP Hit Title [species] eValue links to GenBank
from aa to aa
The closest mouse gene, according to BlastP, is the AceView gene
Based on TaxBlast (BlastP E < .001) related proteins are found in the following organism(s):
Eukaryota 253 hits.
--Pseudocoelomata 5 hits.
----Other Pseudocoelomata 5 hits.
--Protostomia 14 hits.
----Panarthropoda 14 hits.
------Other Panarthropoda 14 hits.
--Deuterostomia 234 hits.
----Chordata 233 hits.
------Teleoste 14 hits.
--------Danio rerio 14 hits, best hit: .
------Amphibia 18 hits.
--------Xenopus laevis 6 hits, best hit: .
--------Other Amphibia 12 hits.
------Amniota 198 hits.
--------Mammalia 190 hits.
----------Eutheria 180 hits.
------------Mus musculus 48 hits, best hit: .
------------Rattus norvegicus 12 hits, best hit: .
------------Homo sapiens 49 hits, best hit: .
------------Other Eutheria 71 hits.
----------Other Mammalia 10 hits.
--------Other Amniota 8 hits.
------Other Chordata 3 hits.
----Other Deuterostomia 1 hit
You may access from the top of the page or from here the
and other annotated mRNAs: , , , , , , , , , , , , , ,
, , , , , , , , , , , , , , ,
To mine knowledge about the gene, please click the 'Gene Summary' or the 'Function, regulation, related genes ' tab at the top of the page. The
page includes all we learnt about the gene, functional annotations of neighboring genes, maps, links to other sites and the bibliography. The
page includes Diseases (D), Pathways, GO annotations, conserved domains (C), interactions (I) reference into function, and pointers to all genes with the same functional annotation.
To compare alternative variants, their summarized annotations, predicted proteins, introns and exons, or to access any sequence, click the
tab. To see a specific mRNA variant diagram, sequence and annotation, click the variant name in the
tab. To examine expression data from all cDNAs clustered in this gene by AceView, click the .
If you know more about this gene, or found errors, please
your knowledge. Thank you !}